PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462926284
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 504aa    MW: 56772 Da    PI: 10.1427
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462926284genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.22.6e-171422151186
                HHTT-EE--HHH.HTT---..--SEEEEEETTS..-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3  11 lksgrlvlpkkfaeehggkkeesktltledesg..rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                l++  l+l   f+ ++g+++++  t+tl+++    +sW v   ++ k+g+y+l kGWk+F+++n LkegD+++F +++
  462926284 142 LEK-ELSLAPAFCGAIGLQEPC--TITLKTSMDiaKSWLVHG-FQSKKGTYLLVKGWKSFCQENSLKEGDICTFNVIK 215
                444.49*************888..56666665566*******.8999999************************9776 PP

2B340.35.8e-134354912986
                -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3  29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                + ++++tl+   +s  sW+v++    + ++++ ++GW +F+++ng+k+gD+++F  ++
  462926284 435 V-TCTITLKTSMSSTSSWQVRVLPYDYCSHHIVGAGWTRFCHENGIKVGDVCTFNIVQ 491
                4.4655666556778*******878888899***********************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.011162IPR003340B3 DNA binding domain
CDDcd100171.59E-7159No hitNo description
SuperFamilySSF1019361.79E-11264IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-10464IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-16128226IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0085133227IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-17138225IPR015300DNA-binding pseudobarrel domain
PfamPF023629.0E-14144221IPR003340B3 DNA binding domain
CDDcd100171.67E-9146211No hitNo description
PROSITE profilePS5086311.053163227IPR003340B3 DNA binding domain
SMARTSM010190.0034398503IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-11436499IPR015300DNA-binding pseudobarrel domain
PfamPF023626.7E-10437495IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.1E-12437499IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.982438503IPR003340B3 DNA binding domain
CDDcd100172.20E-8450487No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MATILGPLGK VYTIQLKMDW LDLFFTGGWS KFVASHGIKE ADFLWLRYER NMSFTVKAFG  60
PDGCRRECKH MDIRVQEFKN LSTCICLSYQ TSTSPEAGKQ KEATSDCIRK DKRKNKASLN  120
RFSSYKIGPP SWIRKQINFN ALEKELSLAP AFCGAIGLQE PCTITLKTSM DIAKSWLVHG  180
FQSKKGTYLL VKGWKSFCQE NSLKEGDICT FNVIKTTLWH VVITRCKEQM NQLCYETTSA  240
SSKKRKIMYD RSGGKGPKRP KGSITSLKKA SSKKGGVFEI GPPAWIKKEI KTSTFQNCLY  300
LSQVFCETIG IHEACTVTLK TSMSSTKFWQ PQVLPYATIL LGPIGRGSAT PCTFNIVETT  360
LWHVVIERCK EQETPSASSR KHTTKYASLE GRKKPNGYMT VLNKAQSKKS GTFDIGPPAW  420
IEKKINLRTI KNRLVTCTIT LKTSMSSTSS WQVRVLPYDY CSHHIVGAGW TRFCHENGIK  480
VGDVCTFNIV QTTLWHVVIT PQIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9S1931e-139A0A0A9S193_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.17e-12B3 family protein